PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008243252.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 234aa    MW: 26248.3 Da    PI: 5.5741
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008243252.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH24.74.2e-08116167455
                     HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH   4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                     +h+ +Er RR++iN+++  L+ l+P ++k +   +  a +L  ++ Y++sLq
  XP_008243252.1 116 SHSLAERVRREKINERLRCLQNLVPGCYKVGEVTMGMAVMLDVVISYVQSLQ 167
                     8*************************87777777888999999999999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.96E-15110185IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.60E-10110171No hitNo description
Gene3DG3DSA:4.10.280.103.1E-14112177IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088814.85112166IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000102.9E-5116167IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.7E-7118172IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MELIDNLCEL ENLSANHHEI MALSNGMSFS DHQRQTNQLP LNFIQDNIQS FSHSDDPNHD  60
VLVAHSTSLT GDFAQESEKG KPLGGRKRKR NNIDKDGEKL KEVIHVRAKR GQATDSHSLA  120
ERVRREKINE RLRCLQNLVP GCYKVGEVTM GMAVMLDVVI SYVQSLQNQI EFLSMKLSAA  180
SVYYDFNSPG VDALDTMQQQ GTNNAYGEVQ EEMVRSEGYG GGLSNYNNNS TWPI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243252.11e-177PREDICTED: transcription factor bHLH75-like isoform X2
SwissprotA4D9986e-49BH075_ARATH; Transcription factor bHLH75
TrEMBLM5XU041e-162M5XU04_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g03720.t011e-73(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25330.16e-49bHLH family protein